ACAD9 Rabbit Polyclonal Antibody

CAT#: TA343058

Rabbit Polyclonal Anti-ACAD9 Antibody

Product Images

WB Suggested Anti-ACAD9 Antibody; Titration: 1.0 ug/ml; Positive Control: 721_B Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACAD9 antibody: synthetic peptide directed towards the C terminal of human ACAD9. Synthetic peptide located within the following region: RSIRIGLRNHDHEVLLANTFCVEAYLQNLFSLSQLDKYAPENLDEQIKKV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 68 kDa
• Gene Name: acyl-CoA dehydrogenase family member 9
• Database Link:
  NP_054768
  Entrez Gene 28976 Human
  UniProt ID Q9H845
• Background: This gene encodes a member of the acyl-CoA dehydrogenase family. Members of this family of proteins localize to the mitochondria and catalyze the rate-limiting step in the beta-oxidation of fatty acyl-CoA. The encoded protein is specifically active toward palmitoyl-CoA and long-chain unsaturated substrates. Mutations in this gene cause acyl-CoA dehydrogenase family member type 9 deficiency.
• Synonyms: NPD002
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Dog: 93%; Mouse: 93%; Rabbit: 93%; Pig: 86%