GPAT4 Rabbit Polyclonal Antibody

CAT#: TA343066

Rabbit Polyclonal Anti-AGPAT6 Antibody

Product Images

WB Suggested Anti-AGPAT6 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AGPAT6 antibody: synthetic peptide directed towards the middle region of human AGPAT6. Synthetic peptide located within the following region: MSKHVHLMCYRICVRALTAIITYHDRENRPRNGGICVANHTSPIDVIILA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: glycerol-3-phosphate acyltransferase 4
• Database Link:
  NP_848934
  Entrez Gene 137964 Human
  UniProt ID Q86UL3
• Background: Lysophosphatidic acid acyltransferases catalyze the conversion of lysophosphatidic acid (LPA) to phosphatidic acid (PA). LPA and PA are involved in signal transduction and lipid biosynthesis.
• Synonyms: 1-AGPAT 6; AGPAT6; LPAAT-zeta; LPAATZ; TSARG7
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Goat: 86%; Mouse: 86%; Zebrafish: 79%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Ether lipid metabolism, Glycerolipid metabolism, Glycerophospholipid metabolism, Metabolic pathways