CYP7B1 Rabbit Polyclonal Antibody

CAT#: TA343076

Rabbit Polyclonal Anti-CYP7B1 Antibody

Product Images

WB Suggested Anti-CYP7B1 Antibody; Titration: 1.0 ug/ml; Positive Control: 721_B Whole Cell CYP7B1 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CYP7B1 antibody: synthetic peptide directed towards the C terminal of human CYP7B1. Synthetic peptide located within the following region: AMYYLLRHPEAMAAVRDEIDRLLQSTGQKKGSGFPIHLTREQLDSLICLE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: cytochrome P450 family 7 subfamily B member 1
• Database Link:
  NP_004811
  Entrez Gene 9420 Human
  UniProt ID O75881
• Background: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum membrane protein catalyzes the first reaction in the cholesterol catabolic pathway of extrahepatic tissues, which converts cholesterol to bile acids. This enzyme likely plays a minor role in total bile acid synthesis, but may also be involved in the development of atherosclerosis, neurosteroid metabolism and sex hormone synthesis.
• Synonyms: CBAS3; CP7B; SPG5A
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Pig: 86%; Rat: 86%; Bovine: 85%; Rabbit: 85%

Reference Data

• Protein Families: Druggable Genome, P450, Transmembrane
• Protein Pathways: Primary bile acid biosynthesis