H3FA (HIST1H3A) Rabbit Polyclonal Antibody

CAT#: TA343093

Rabbit Polyclonal Anti-HIST1H3A Antibody

Product Images

WB Suggested Anti-HIST1H3A Antibody; Titration: 1.0 ug/ml; Positive Control: Jurkat Whole Cell

• 

  Host: Rabbit; Target Name: HIST1H3A; Sample Tissue: Human 721_B; Antibody Dilution: 1.0 ug/ml HIST1H3A is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HIST1H3A antibody: synthetic peptide directed towards the N terminal of human HIST1H3A. Synthetic peptide located within the following region: KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 15 kDa
• Gene Name: histone cluster 1, H3a
• Database Link:
  NP_003520
  Entrez Gene 8350 Human
  UniProt ID P68431
• Background: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3.
• Synonyms: A; H3; H3FA
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Zebrafish: 100%

Reference Data

• Protein Pathways: Systemic lupus erythematosus