CCS Rabbit Polyclonal Antibody

CAT#: TA343094

Rabbit Polyclonal Anti-CCS Antibody

Product Images

WB Suggested Anti-CCS Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CCS antibody: synthetic peptide directed towards the middle region of human CCS. Synthetic peptide located within the following region: LHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: copper chaperone for superoxide dismutase
• Database Link:
  NP_005116
  Entrez Gene 9973 Human
  UniProt ID O14618
• Background: Copper chaperone for superoxide dismutase specifically delivers Cu to copper/zinc superoxide dismutase and may activate copper/zinc superoxide dismutase through direct insertion of the Cu cofactor.
• Synonyms: MGC138260
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rabbit: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Horse: 92%; Sheep: 92%; Bovine: 92%; Guinea pig: 92%; Zebrafish: 90%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Amyotrophic lateral sclerosis (ALS)