LHCGR Rabbit Polyclonal Antibody
Other products for "LHCGR"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-LHCGR antibody is: synthetic peptide directed towards the C-terminal region of Human LHCGR. Synthetic peptide located within the following region: LLLSKFGCCKRRAELYRRKDFSAYTSNCKNGFTGSNKPSQSTLKLSTLHC |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 69 kDa |
Gene Name | luteinizing hormone/choriogonadotropin receptor |
Database Link | |
Background | This gene encodes the receptor for both luteinizing hormone and choriogonadotropin. This receptor belongs to the G-protein coupled receptor 1 family, and its activity is mediated by G proteins which activate adenylate cyclase. Mutations in this gene result in disorders of male secondary sexual character development, including familial male precocious puberty, also known as testotoxicosis, hypogonadotropic hypogonadism, Leydig cell adenoma with precocious puberty, and male pseudohermaphtoditism with Leydig cell hypoplasia. |
Synonyms | CG-R; CGR; HHG; LCGR; LGR2; LH; LHR; LHRHR; LSH-R; ULG5 |
Note | Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 93%; Goat: 93%; Bovine: 93%; Rat: 86%; Horse: 86%; Rabbit: 86%; Guinea pig: 86% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Calcium signaling pathway, Neuroactive ligand-receptor interaction |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.