RACK1 Rabbit Polyclonal Antibody

CAT#: TA343147

Rabbit Polyclonal Anti-GNB2L1 Antibody

Product Images

Host: Rabbit; Target Name: Gnb2l1; Sample Tissue: Mouse Stomach lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Gnb2l1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Gnb2l1. Synthetic peptide located within the following region: HIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIIN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: receptor for activated C kinase 1
• Database Link:
  NP_006089
  Entrez Gene 14694 Mouse
  UniProt ID P63244
• Background: Gnb2l1 is involved in the recruitment, assembly and/or regulation of a variety of signaling molecules. Gnb2l1 interacts with a wide variety of proteins and plays a role in many cellular processes.
• Synonyms: Gnb2-rs1; GNB2L1; H12.3; HLC-7; PIG21
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome