EIF4B Rabbit Polyclonal Antibody

CAT#: TA343151

Rabbit Polyclonal Anti-EIF4B Antibody

Product Images

Host: Rabbit; Target Name: Eif4b; Sample Tissue: Mouse Brain lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Eif4b antibody is: synthetic peptide directed towards the C-terminal region of Mouse Eif4b. Synthetic peptide located within the following region: DGGSRDHWKDLDRKDGKKDQDSRSAPEPKKPEENPASKFSSASKYAALSV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: eukaryotic translation initiation factor 4B
• Database Link:
  NP_001408
  Entrez Gene 75705 Mouse
  UniProt ID P23588
• Background: The function of this protein remains unknown.
• Synonyms: EIF-4B; PRO1843
• Note: Immunogen Sequence Homology: Bovine: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Human: 93%; Mouse: 93%; Guinea pig: 93%; Rabbit: 86%

Reference Data

• Protein Pathways: mTOR signaling pathway