ARMER (ARL6IP1) Rabbit Polyclonal Antibody

CAT#: TA343158

Rabbit Polyclonal Anti-ARL6IP1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ARL6IP1"

Specifications

Product Data
Recommended Dilution WB
Reactivities Rat
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Arl6ip1 antibody is: synthetic peptide directed towards the middle region of Rat Arl6ip1. Synthetic peptide located within the following region: GVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 22 kDa
Gene Name ADP ribosylation factor like GTPase 6 interacting protein 1
Background Mouse homolog interacts with ADP-ribosylation-like factor-6 (ARL6); Arl6ip1 may play a role in hematopoetic maturation.
Synonyms AIP1; ARL6IP; ARMER; SPG61
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 93%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.