E2F6 Rabbit Polyclonal Antibody

CAT#: TA343159

Rabbit Polyclonal Anti-E2F6 Antibody

Specifications

Product Data

• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-E2f6 antibody is: synthetic peptide directed towards the middle region of Rat E2f6. Synthetic peptide located within the following region: RRVYDITNVLDGIELVEKKSKNHIRWIGSDLNNFGAAPQQKKLQAELSDL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: E2F transcription factor 6
• Database Link:
  NP_937987
  Entrez Gene 313978 Rat
  UniProt ID O75461
• Background: Mouse homolog is a transcription factor and is involved in the regulation of cell cycle progression.
• Synonyms: E2F-6
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Mouse: 93%; Guinea pig: 93%; Rabbit: 85%

Reference Data

• Protein Families: Transcription Factors