D4 (ARHGDIB) Rabbit Polyclonal Antibody

CAT#: TA343165

Rabbit Polyclonal Anti-ARHGDIB Antibody

Product Images

Host: Rabbit; Target Name: ARHGDIB; Sample Tissue: 721_B Whole Cell lysates; Antibody Dilution: 1.0 ug/ml ARHGDIB is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ARHGDIB antibody is: synthetic peptide directed towards the N-terminal region of Human ARHGDIB. Synthetic peptide located within the following region: MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: Rho GDP dissociation inhibitor beta
• Database Link:
  NP_001166
  Entrez Gene 397 Human
  UniProt ID P52566
• Background: Members of the Rho (or ARH) protein family and other Ras-related small GTP-binding proteins are involved in diverse cellular events, including cell signaling, proliferation, cytoskeletal organization, and secretion. The GTP-binding proteins are active only in the GTP-bound state. At least 3 classes of proteins tightly regulate cycling between the GTP-bound and GDP-bound states: GTPase-activating proteins (GAPs), guanine nucleotide-releasing factors (GRFs), and GDP-dissociation inhibitors (GDIs). The GDIs, including ARHGDIB, decrease the rate of GDP dissociation from Ras-like GTPases.
• Synonyms: D4; GDIA2; GDID4; Ly-GDI; LYGDI; RAP1GN1; RhoGDI2
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Human: 93%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Neurotrophin signaling pathway