RAB31 Rabbit Polyclonal Antibody

CAT#: TA343183

Rabbit Polyclonal Anti-RAB31 Antibody

Product Images

Host: Rabbit; Target Name: Rab31; Sample Tissue: Rat Brain lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Rab31 antibody is: synthetic peptide directed towards the middle region of Rat Rab31. Synthetic peptide located within the following region: GSAAAVIVYDITKQDSFHTLKKWVKELKEHGPENIVMAIAGNKCDLSDIR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: RAB31, member RAS oncogene family
• Database Link:
  NP_006859
  Entrez Gene 246324 Rat
  UniProt ID Q13636
• Background: Rab31 is an oligodendrocyte Rab protein.
• Synonyms: Rab22B
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Endocytosis