TIPRL Rabbit Polyclonal Antibody

CAT#: TA343190

Rabbit Polyclonal Anti-TIPRL Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "TIPRL"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TIPRL antibody is: synthetic peptide directed towards the C-terminal region of Human TIPRL. Synthetic peptide located within the following region: SLMHVPPSLFTEPNEISQYLPIKEAVCEKLIFPERIDPNPADSQKSTQVE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 29 kDa
Gene Name TOR signaling pathway regulator
Background TIPRL is an inhibitory regulator of protein phosphatase-2A (PP2A), PP4, and PP6.
Synonyms TIP; TIP41
Note Immunogen Sequence Homology: Human: 100%; Dog: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.