PLCXD1 Rabbit Polyclonal Antibody

CAT#: TA343256

Rabbit Polyclonal Anti-PLCXD1 Antibody

Product Images

WB Suggested Anti-PLCXD1 Antibody; Titration: 1.0 ug/ml; Positive Control: 721_B Whole Cell PLCXD1 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PLCXD1 antibody is: synthetic peptide directed towards the C-terminal region of PLCXD1. Synthetic peptide located within the following region: YWWGNRVKTEALIRYLETMKSCGRPGGLFVAGINLTENLQYVLAHPSESL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: phosphatidylinositol specific phospholipase C X domain containing 1
• Database Link:
  NP_060860
  Entrez Gene 55344 Human
  UniProt ID Q9NUJ7
• Background: This gene is the most terminal protein-coding gene in the pseudoautosomal (PAR) region on chromosomes X and Y. Alternate splicing results in multiple transcript variants.
• Synonyms: LL0XNC01-136G2.1
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Rabbit: 93%; Rat: 90%; Bovine: 86%