VEGFC Rabbit Polyclonal Antibody

CAT#: TA343278

Rabbit Polyclonal Anti-VEGFC Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "VEGFC"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-VEGFC antibody is: synthetic peptide directed towards the C-terminal region of Human VEGFC. Synthetic peptide located within the following region: LDEETCQCVCRAGLRPASCGPHKELDRNSCQCVCKNKLFPSQCGANREFD
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 46 kDa
Gene Name vascular endothelial growth factor C
Background The protein encoded by this gene is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family, is active in angiogenesis and endothelial cell growth, and can also affect the permeability of blood vessels. This secreted protein undergoes a complex proteolytic maturation, generating multiple processed forms which bind and activate VEGFR-3 receptors. Only the fully processed form can bind and activate VEGFR-2 receptors. This protein is structurally and functionally similar to vascular endothelial growth factor D.
Synonyms Flt4-L; LMPH1D; VRP
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Rabbit: 93%; Bovine: 92%; Rat: 86%; Mouse: 86%; Guinea pig: 86%
Reference Data
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Bladder cancer, Cytokine-cytokine receptor interaction, Focal adhesion, mTOR signaling pathway, Pancreatic cancer, Pathways in cancer, Renal cell carcinoma

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.