CD79A Rabbit Polyclonal Antibody

CAT#: TA343279

Rabbit Polyclonal Anti-CD79A Antibody

Product Images

Host: Rabbit; Target Name: CD79A; Sample Tissue: HT1080 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CD79A antibody is: synthetic peptide directed towards the C-terminal region of Human CD79A. Synthetic peptide located within the following region: AVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: CD79a molecule
• Database Link:
  NP_001774
  Entrez Gene 973 Human
  UniProt ID P11912
• Background: The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-alpha protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described.
• Synonyms: IGA; MB-1
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 83%; Yeast: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: B cell receptor signaling pathway, Primary immunodeficiency