SRMS Rabbit Polyclonal Antibody

CAT#: TA343305

Rabbit Polyclonal Anti-SRMS Antibody

Product Images

WB Suggested Anti-SRMS Antibody; Titration: 1.0 ug/ml; Positive Control: MCF7 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SRMS antibody is: synthetic peptide directed towards the C-terminal region of SRMS. Synthetic peptide located within the following region: QQIMRGYRLPRPAACPAEVYVLMLECWRSSPEERPSFATLREKLHAIHRC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites
• Database Link:
  NP_543013
  Entrez Gene 6725 Human
  UniProt ID Q9H3Y6
• Background: SRMS may be involved in proliferation or differentiation of keratinocytes in the skin.
• Synonyms: C20orf148; dJ697K14.1; PTK70; SRM
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 82%; Pig: 82%; Horse: 82%; Bovine: 82%; Rat: 79%; Zebrafish: 75%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase