IL13 receptor alpha 1 (IL13RA1) Rabbit Polyclonal Antibody

CAT#: TA343310

Rabbit Polyclonal Anti-IL13RA1 Antibody

Product Images

WB Suggested Anti-IL13RA1 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal kidney

• 

  Sample Type : Lane 1: 60ug mouse CT26 lysate Lane 2: 60ug mouse MC38 lysate Primary Antibody Dilution : 1:1000 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1:5000 Color/Signal Descriptions: IL13RA1 Gene Name: Miranda A. Hallett, Vander

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IL13RA1 antibody is: synthetic peptide directed towards the N-terminal region of IL13RA1. Synthetic peptide located within the following region: VSVENLCTVIWTWNPPEGASSNCSLWYFSHFGDKQDKKIAPETRRSIEVP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: interleukin 13 receptor subunit alpha 1
• Database Link:
  NP_001551
  Entrez Gene 16164 MouseEntrez Gene 3597 Human
  UniProt ID P78552
• Background: The protein encoded by this gene is a subunit of the interleukin 13 receptor. This subunit forms a receptor complex with IL4 receptor alpha, a subunit shared by IL13 and IL4 receptors. This subunit serves as a primary IL13-binding subunit of the IL13 receptor, and may also be a component of IL4 receptors. This protein has been shown to bind tyrosine kinase TYK2, and thus may mediate the signaling processes that lead to the activation of JAK1, STAT3 and STAT6 induced by IL13 and IL4.
• Synonyms: CD213A1; CT19; IL-13Ra; NR4
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Horse: 92%; Sheep: 92%; Bovine: 92%; Rat: 86%; Dog: 85%; Pig: 85%; Mouse: 85%; Guinea pig

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway