CD1E Rabbit Polyclonal Antibody

CAT#: TA343311

Rabbit Polyclonal Anti-CD1E Antibody

Product Images

Host: Rabbit; Target Name: CD1E; Sample Tissue: NCI-H226 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CD1E antibody is: synthetic peptide directed towards the C-terminal region of Human CD1E. Synthetic peptide located within the following region: WVMWMRGEQEQRGTQRGDVLPNADETWWIFHLSHPDLFDCDSYPGHIGCS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: CD1e molecule
• Database Link:
  NP_112155
  Entrez Gene 913 Human
  UniProt ID P15812
• Background: This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes within Golgi compartments, endosomes, and lysosomes, and is cleaved into a stable soluble form. The soluble form is required for the intracellular processing of some glycolipids into a form that can be presented by other CD1 family members. Many alternatively spliced transcript variants encoding different isoforms have been described. Additional transcript variants have been found; however, their biological validity has not been determined.
• Synonyms: CD1A; R2
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Bovine: 100%; Pig: 86%; Horse: 86%; Rat: 79%; Mouse: 79%; Sheep: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Hematopoietic cell lineage