IDUA Rabbit Polyclonal Antibody

CAT#: TA343326

Rabbit Polyclonal Anti-IDUA Antibody

Product Images

Host: Rabbit; Target Name: Idua; Sample Tissue: Mouse Kidney lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Idua antibody is: synthetic peptide directed towards the middle region of MOUSE Idua. Synthetic peptide located within the following region: MENQLLPGFELMGSPSGYFTDFDDKQQVFEWKDLVSLLARRYIGRYGLTH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: iduronidase, alpha-L-
• Database Link:
  NP_000194
  Entrez Gene 15932 Mouse
  UniProt ID P35475
• Background: The function of this protein remains unknown.
• Synonyms: IDA; MPS1
• Note: Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Rat: 93%; Dog: 90%; Mouse: 86%; Bovine: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Glycosaminoglycan degradation, Lysosome, Metabolic pathways