PDGF AA (PDGFA) Rabbit Polyclonal Antibody

CAT#: TA343338

Rabbit Polyclonal Anti-PDGFA Antibody

Product Images

Host: Rabbit; Target Name: PDGFA; Sample Tissue: U937 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PDGFA antibody is: synthetic peptide directed towards the C-terminal region of Human PDGFA. Synthetic peptide located within the following region: HRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTDVR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: platelet derived growth factor subunit A
• Database Link:
  NP_148983
  Entrez Gene 5154 Human
  UniProt ID P04085
• Background: The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. This gene product can exist either as a homodimer or as a heterodimer with the platelet-derived growth factor beta polypeptide, where the dimers are connected by disulfide bonds. Studies using knockout mice have shown cellular defects in oligodendrocytes, alveolar smooth muscle cells, and Leydig cells in the testis; knockout mice die either as embryos or shortly after birth. Two splice variants have been identified for this gene.
• Synonyms: PDGF-A; PDGF1
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 85%; Rat: 85%; Mouse: 85%; Pig: 82%; Guinea pig: 82%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Cytokine-cytokine receptor interaction, Focal adhesion, Gap junction, Glioma, MAPK signaling pathway, Melanoma, Pathways in cancer, Prostate cancer, Regulation of actin cytoskeleton