TCF3 / E2A (TCF3) Rabbit Polyclonal Antibody
Other products for "TCF3"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TCF3 antibody: synthetic peptide directed towards the N terminal of human TCF3. Synthetic peptide located within the following region: MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 68 kDa |
Gene Name | transcription factor 3 |
Database Link | |
Background | TCF3 contains 1 basic helix-loop-helix (bHLH) domain. Heterodimers between TCF3 and tissue-specific basic helix-loop-helix (bHLH) proteins play major roles in determining tissue-specific cell fate during embryogenesis, like muscle or early B-cell differentiation. Dimers bind DNA on E-box motifs: 5'-CANNTG-3'. TCF3 binds to the kappa-E2 site in the kappa immunoglobulin gene enhancer. |
Synonyms | AGM8; bHLHb21; E2A; E47; ITF1; TCF-3; VDIR |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 93%; Guinea pig: 92%; Mouse: 86%; Rabbit: 77% |
Reference Data | |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transcription Factors |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.