TCF3 / E2A (TCF3) Rabbit Polyclonal Antibody

CAT#: TA343367

Rabbit Polyclonal Anti-TCF3 Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "TCF3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TCF3 antibody: synthetic peptide directed towards the N terminal of human TCF3. Synthetic peptide located within the following region: MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 68 kDa
Gene Name transcription factor 3
Background TCF3 contains 1 basic helix-loop-helix (bHLH) domain. Heterodimers between TCF3 and tissue-specific basic helix-loop-helix (bHLH) proteins play major roles in determining tissue-specific cell fate during embryogenesis, like muscle or early B-cell differentiation. Dimers bind DNA on E-box motifs: 5'-CANNTG-3'. TCF3 binds to the kappa-E2 site in the kappa immunoglobulin gene enhancer.
Synonyms AGM8; bHLHb21; E2A; E47; ITF1; TCF-3; VDIR
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 93%; Guinea pig: 92%; Mouse: 86%; Rabbit: 77%
Reference Data
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.