ZNF133 Rabbit Polyclonal Antibody

CAT#: TA343397

Rabbit Polyclonal Anti-ZNF133 Antibody

Product Images

WB Suggested Anti-ZNF133 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: THP-1 cell lysate

• 

  Three cryosections on each slide were stained with a single antibody. The fourth slice was used as a negative control (primary antibody omitted). The tissue was fixed with cold acetone for 10 minutes, rinsed in phosphate buffered saline (PBS) and incubate

Specifications

Product Data

• Applications: IF, WB
• Recommended Dilution: WB, IF
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF133 antibody: synthetic peptide directed towards the middle region of human ZNF133. Synthetic peptide located within the following region: KPYVCKTCGRGFSLKSHLSRHRKTTSVHHRLPVQPDPEPCAGQPSDSLYS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 73 kDa
• Gene Name: zinc finger protein 133
• Database Link:
  NP_003425
  Entrez Gene 7692 Human
  UniProt ID P52736
• Background: ZNF193 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 5 C2H2-type zinc fingers and 1 SCAN box domain. ZNF193 may be involved in transcriptional regulation.
• Synonyms: pHZ-13; pHZ-66; ZNF150
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 77%; Rabbit: 77%

Reference Data

• Protein Families: Transcription Factors