ZFP200 (ZNF200) Rabbit Polyclonal Antibody

CAT#: TA343406

Rabbit Polyclonal Anti-ZNF200 Antibody

Product Images

WB Suggested Anti-ZNF200 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: OVCAR-3 cell lysate; ZNF200 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF200 antibody: synthetic peptide directed towards the middle region of human ZNF200. Synthetic peptide located within the following region: SRHEGIHIREKIFKCPECGKTFPKNEEFVLHLQSHEAERPYGCKKCGRRF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: zinc finger protein 200
• Database Link:
  NP_003445
  Entrez Gene 7752 Human
  UniProt ID P98182
• Background: ZNF200 contains 5 C2H2-type zinc fingers. ZNF200 could have a role in spermatogenesis.
• Synonyms: MGC45293
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Horse: 93%; Rabbit: 86%; Bovine: 77%

Reference Data

• Protein Families: Transcription Factors