ZNF259 (ZPR1) Rabbit Polyclonal Antibody

CAT#: TA343430

Rabbit Polyclonal Anti-ZNF259 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ZPR1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF259 antibody: synthetic peptide directed towards the N terminal of human ZNF259. Synthetic peptide located within the following region: PPGAAVAPSPAPAPPPAPDHLFRPISAEDEEQQPTEIESLCMNCYCNGMT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 51 kDa
Gene Name ZPR1 zinc finger
Background ZNF259 may be a signaling molecule that communicates mitogenic signals from the cytoplasm to the nucleus. ZNF259 binds to the EGFR and is released from the receptor after activation.ZNF259 is essential for cell viability and its interaction with eEF-1alpha contributes to normal cellular proliferation.ZNF259 translocates from the cytoplasm to the nucleus after treatment of cells with mitogens. ZNF259 accumulates in the nucleolus of proliferating cells. Loss of ZNF259 caused disruption of nucleolar function, including preribosomal RNA expression. ZNF259 is an essential protein that is required for normal nucleolar function in proliferating cells.
Synonyms ZNF259
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.