ZNF259 (ZPR1) Rabbit Polyclonal Antibody

CAT#: TA343431

Rabbit Polyclonal Anti-ZNF259 Antibody

Product Images

WB Suggested Anti-ZNF259 Antibody Titration: 0.03 ug/ml; ELISA Titer: 1: 312500; Positive Control: Jurkat cell lysate; ZNF259 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF259 antibody: synthetic peptide directed towards the C terminal of human ZNF259. Synthetic peptide located within the following region: GNSYLQNVYAPEDDPEMKVERYKRTFDQNEELGLNDMKTEGYEAGLAPQR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: ZPR1 zinc finger
• Database Link:
  NP_003895
  Entrez Gene 8882 Human
  UniProt ID O75312
• Background: ZNF259 may be a signaling molecule that communicates mitogenic signals from the cytoplasm to the nucleus. ZNF259 binds to the EGFR and is released from the receptor after activation.ZNF259 is essential for cell viability and its interaction with eEF-1alpha contributes to normal cellular proliferation.ZNF259 translocates from the cytoplasm to the nucleus after treatment of cells with mitogens. ZNF259 accumulates in the nucleolus of proliferating cells. Loss of ZNF259 caused disruption of nucleolar function, including preribosomal RNA expression. ZNF259 is an essential protein that is required for normal nucleolar function in proliferating cells.
• Synonyms: ZNF259
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%; Goat: 85%