TANK Rabbit Polyclonal Antibody

CAT#: TA343442

Rabbit Polyclonal Anti-TANK Antibody

Product Images

WB Suggested Anti-TANK Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TANK antibody: synthetic peptide directed towards the C terminal of human TANK. Synthetic peptide located within the following region: KPFPNQDSDSVVLSGTDSELHIPRVCEFCQAVFPPSITSRGDFLRHLNSH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: TRAF family member associated NFKB activator
• Database Link:
  NP_004171
  Entrez Gene 10010 Human
  UniProt ID Q92844
• Background: The TRAF (tumor necrosis factor receptor-associated factor) family of proteins associate with and transduce signals from members of the tumor necrosis factor receptor superfamily. TANK is found in the cytoplasm and can bind to TRAF1, TRAF2, or TRAF3, ther
• Synonyms: I-TRAF; ITRAF; TRAF2
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Rat: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: RIG-I-like receptor signaling pathway