FOXA1 Rabbit Polyclonal Antibody

CAT#: TA343465

Rabbit Polyclonal Anti-FOXA1 Antibody

Product Images

Sample Type: 1. Control (20ug); 2. shRNA1-FOXA1 H9 hES cells (20ug); 3. shRNA2-FOXA1 H9 hES cells (20ug); Primary Dilution: 1: 1000; Secondary Antibody: anti-Rabbit HRP; Secondary Dilution: 1: 5000; Image Submitted By: Jingli Cai; Thomas Jefferson Univers

• 

  WB Suggested Anti-FOXA1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 721_B cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FOXA1 antibody: synthetic peptide directed towards the N terminal of human FOXA1. Synthetic peptide located within the following region: LGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: forkhead box A1
• Database Link:
  NP_004487
  Entrez Gene 3169 Human
  UniProt ID P55317
• Background: FOXA1 is a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver.This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: HNF3A; TCF3A
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Bovine: 93%; Mouse: 86%; Rabbit: 85%; Zebrafish: 85%; Guinea pig: 85%

Reference Data

• Protein Families: ES Cell Differentiation/IPS, Transcription Factors