AF9 (MLLT3) Rabbit Polyclonal Antibody

CAT#: TA343472

Rabbit Polyclonal Anti-MLLT3 Antibody

Product Images

Host: Rabbit; Target Name: MLLT3; Sample Tissue: 721_B cell lysate; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MLLT3 antibody: synthetic peptide directed towards the N terminal of human MLLT3. Synthetic peptide located within the following region: MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 63 kDa
• Gene Name: myeloid/lymphoid or mixed-lineage leukemia; translocated to, 3
• Database Link:
  NP_004520
  Entrez Gene 4300 Human
  UniProt ID P42568
• Background: MLLT3 is a regulator of early erythroid and megakaryocytic cell fate in the human system. Expression of MLLT3 in human CD34+ cells induces acute myeloid, lymphoid, or mixed-lineage leukemia in immunodeficient mice. Translocation t (9;11)(p22;q23), a chromosomal aberration involving MLLT3 is associated with acute leukemias.
• Synonyms: AF9; YEATS3
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Pig: 86%; Rat: 86%; Horse: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Transcription Factors