IKB epsilon (NFKBIE) Rabbit Polyclonal Antibody

CAT#: TA343475

Rabbit Polyclonal Anti-NFKBIE Antibody

Product Images

WB Suggested Anti-NFKBIE Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: HT1080 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NFKBIE antibody: synthetic peptide directed towards the middle region of human NFKBIE. Synthetic peptide located within the following region: DARMLNGCTPLHLAAGRGLMGISSTLCKAGADSLLRNVEDETPQDLTEES
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: NFKB inhibitor epsilon
• Database Link:
  NP_004547
  Entrez Gene 18037 MouseEntrez Gene 4794 Human
  UniProt ID O00221
• Background: NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008 or NFKBIB, MIM 604495), which inactivate NF-ka
• Synonyms: IKBE
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Rat: 92%; Mouse: 92%; Guinea pig: 92%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Adipocytokine signaling pathway, B cell receptor signaling pathway, Neurotrophin signaling pathway, T cell receptor signaling pathway