CBF1 interacting corepressor (CIR1) Rabbit Polyclonal Antibody
Other products for "CIR1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CIR antibody: synthetic peptide directed towards the C terminal of human CIR. Synthetic peptide located within the following region: RSRSPGSYKQRETRKRAQRNPGEEQSRRNDSRSHGTDLYRGEKMYREHPG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 52 kDa |
Gene Name | corepressor interacting with RBPJ, 1 |
Database Link | |
Background | CIR may modulate splice site selection during alternative splicing of pre-mRNAs. CIR regulates transcription and acts as corepressor for RBPSUH by recruiting RBPSUH to the Sin3-histone deacetylase complex (HDAC). CIR is also required for RBPSUH-mediated repression of transcription. |
Synonyms | CIR |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data | |
Protein Families | Transcription Factors |
Protein Pathways | Notch signaling pathway |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.