ER81 (ETV1) Rabbit Polyclonal Antibody

CAT#: TA343491

Rabbit Polyclonal Anti-ETV1 Antibody

Product Images

WB Suggested Anti-ETV1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: HT1080 cell lysate

• 

  WB Suggested Anti-ETV1 Antibody; Positive Control: Lane 1: 100ug untransfected HEK293 lysate Lane 2: 33ug ER81 transfected HEK293 lysate; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Anti-rabbit-HRP; Secondry Antibody Dilution: 1: 2000; Submitt

• 

  Immunohistochemistry with Brain, cortex tissue at an antibody concentration of 5 ug/ml using anti-ETV1 antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ETV1 antibody: synthetic peptide directed towards the middle region of human ETV1. Synthetic peptide located within the following region: PDNQRPLLKTDMERHINEEDTVPLSHFDESMAYMPEGGCCNPHPYNEGYV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: ETS variant 1
• Database Link:
  NP_004947
  Entrez Gene 2115 Human
  UniProt ID P50549
• Background: ETV1 is a transcriptional activator that binds to DNA sequences containing the consensus pentanucleotide 5'-CGGA[AT]-3'.
• Synonyms: ER81
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 86%; Zebrafish: 86%

Reference Data

• Protein Families: ES Cell Differentiation/IPS, Transcription Factors