EVI1 (MECOM) Rabbit Polyclonal Antibody

CAT#: TA343493

Rabbit Polyclonal Anti-MDS1 Antibody

Product Images

WB Suggested Anti-MDS1 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1: 312500; Positive Control: Raji cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MDS1 antibody: synthetic peptide directed towards the N terminal of human MDS1. Synthetic peptide located within the following region: MRSKGRARKLATNNECVYGNYPEIPLEEMPDADGVASTPSLNIQEPCSPA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 19 kDa
• Gene Name: MDS1 and EVI1 complex locus
• Database Link:
  NP_004982
  Entrez Gene 2122 Human
  UniProt ID Q03112
• Background: MDS1 is located at 3q26 170-400 kb upstream (telomeric) of EVI1 in the chromosomal region in which some of the breakpoints 5' of EVI1 have been mapped. MDS1 has been identified as a single gene as well as a previously unreported exon(s) of EVI1. MDS1 exists in normal tissues both as a unique transcript and as a normal fusion transcript with EVI1, with an additional 188 codons at the 5' end of the previously reported EVI1 open reading frame. In cells with translocation t (3;21), additional fusion transcripts are AML1-MDS1 and AML1-MDS1-EVI1. EVI1 and MDS1 are involved in leukemia associated with chromosomal translocation breakpoints in the region between these genes.
• Synonyms: AML1-EVI-1; EVI1; MDS1; MDS1-EVI1; PRDM3
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 93%; Zebrafish: 77%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Chronic myeloid leukemia, MAPK signaling pathway, Pathways in cancer