MTGR1 (CBFA2T2) Rabbit Polyclonal Antibody

CAT#: TA343502

Rabbit Polyclonal Anti-CBFA2T2 Antibody

Product Images

WB Suggested Anti-CBFA2T2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HepG2 cell lysate; CBFA2T2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CBFA2T2 antibody: synthetic peptide directed towards the N terminal of human CBFA2T2. Synthetic peptide located within the following region: AKESGISLKEIQVLARQWKVGPEKRVPAMPGSPVEVKIQSRSSPPTMPPL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 67 kDa
• Gene Name: CBFA2/RUNX1 translocation partner 2
• Database Link:
  NP_005084
  Entrez Gene 9139 Human
  UniProt ID O43439
• Background: In acute myeloid leukemia, especially in the M2 subtype, the t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities. The translocation produces a chimeric gene made up of the 5'-region of the RUNX1 (AML1) gene fused to the 3'-region of the CBFA2T1 (MTG8) gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. CBFA2T2 binds to the AML1-MTG8 complex and may be important in promoting leukemogenesis. In acute myeloid leukemia, especially in the M2 subtype, the t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities. The translocation produces a chimeric gene made up of the 5'-region of the RUNX1 (AML1) gene fused to the 3'-region of the CBFA2T1 (MTG8) gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. The protein encoded by this gene binds to the AML1-MTG8 complex and may be important in promoting leukemogenesis. Several transcript variants are thought to exist for this gene, but the full-length natures of only three have been described.
• Synonyms: EHT; MTGR1; p85; ZMYND3
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transcription Factors