Rabbit polyclonal antibody to CBFA2T2 (core-binding factor, runt domain, alpha subunit 2; translocated to, 2)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 401 and 604 of CBFA2T2 (Uniprot ID#O43439) |
Cbfa2t2 rat monoclonal antibody, clone KT42, Aff - Purified
| Applications | IP, WB |
| Reactivities | Mouse |
Cbfa2t2 rat monoclonal antibody, clone KT42, Aff - Purified
| Applications | IP, WB |
| Reactivities | Mouse |
Cbfa2t2 rat monoclonal antibody, clone KT42, Aff - Purified
| Applications | IP, WB |
| Reactivities | Mouse |
Rabbit polyclonal CBFA2T2 Antibody (N-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CBFA2T2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-29 amino acids from the N-terminal region of human CBFA2T2. |
MTGR1 (CBFA2T2) sheep polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | C terminal portion of recombinant protein |
Rabbit polyclonal anti-Cbfa2t2 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cbfa2t2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AVLRRCQESDREELNYWKRRFNENTELRKTGTELVSRQHSPGSTDSLSND |
Rabbit polyclonal anti-CBFA2T2H antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CBFA2T2H antibody: synthetic peptide directed towards the middle region of mouse CBFA2T2H. Synthetic peptide located within the following region: RRSMAVLRRCQESDREELNYWKRRFNENTELRKTGTELVSRQHSPGSTDS |
Rabbit Polyclonal Anti-CBFA2T2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CBFA2T2 antibody: synthetic peptide directed towards the N terminal of human CBFA2T2. Synthetic peptide located within the following region: AKESGISLKEIQVLARQWKVGPEKRVPAMPGSPVEVKIQSRSSPPTMPPL |
Rabbit Polyclonal Anti-NFATC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFATC1 antibody: synthetic peptide directed towards the middle region of human NFATC1. Synthetic peptide located within the following region: STLMPAAPGVSPKLHDLSPAAYTKGVASPGHCHLGLPQPAGEAPAVQDVP |
CBFA2T2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CBFA2T2 |
CBFA2T2 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 325-604 of human CBFA2T2 (NP_005084.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
