MTGR1 (CBFA2T2) Rabbit Polyclonal Antibody

CAT#: TA343585

Rabbit Polyclonal Anti-NFATC1 Antibody

Product Images

WB Suggested Anti-NFATC1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: NCI-H226 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NFATC1 antibody: synthetic peptide directed towards the middle region of human NFATC1. Synthetic peptide located within the following region: STLMPAAPGVSPKLHDLSPAAYTKGVASPGHCHLGLPQPAGEAPAVQDVP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 89 kDa
• Gene Name: CBFA2/RUNX1 translocation partner 2
• Database Link:
  NP_005084
  Entrez Gene 9139 Human
  UniProt ID O43439
• Background: NFATC1 is a component of the nuclear factor of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation
• Synonyms: EHT; MTGR1; p85; ZMYND3
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transcription Factors