NR1D2 Rabbit Polyclonal Antibody
Other products for "NR1D2"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-NR1D2 antibody: synthetic peptide directed towards the N terminal of human NR1D2. Synthetic peptide located within the following region: YISSSSSASSHASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGDL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 65 kDa |
Gene Name | nuclear receptor subfamily 1 group D member 2 |
Database Link | |
Background | NR1D2 can interact with NCOA5 coactivator, leading to a strong increase of transcription of target genes. NR1D2 also binds to the sequences 5'-AATGTAGGTCA-3' and 5'-ATAACTAGGTCA-3' and acts as a potent competitive transcriptional silencer and negative regulator of RORalpha mediated trans-activation. NR1D2 may play different roles in metabolism, inflammation, and circadian cycling in the organ-specific manner in homeostasis. |
Synonyms | BD73; EAR-1R; RVR |
Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Pig: 86%; Mouse: 86%; Guinea pig: 86%; Bovine: 79% |
Reference Data | |
Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.