NR1D2 Rabbit Polyclonal Antibody

CAT#: TA343508

Rabbit Polyclonal Anti-NR1D2 Antibody

Product Images

WB Suggested Anti-NR1D2 Antibody Titration: 0.5 ug/ml; ELISA Titer: 1: 62500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NR1D2 antibody: synthetic peptide directed towards the C terminal of human NR1D2. Synthetic peptide located within the following region: ETLIRALRTLIMKNHPNEASIFTKLLLKLPDLRSLNNMHSEELLAFKVHP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 65 kDa
• Gene Name: nuclear receptor subfamily 1 group D member 2
• Database Link:
  NP_005117
  Entrez Gene 9975 Human
  UniProt ID Q14995
• Background: NR1D2 can interact with NCOA5 coactivator, leading to a strong increase of transcription of target genes. NR1D2 also binds to the sequences 5'-AATGTAGGTCA-3' and 5'-ATAACTAGGTCA-3' and acts as a potent competitive transcriptional silencer and negative regulator of RORalpha mediated trans-activation. NR1D2 may play different roles in metabolism, inflammation, and circadian cycling in the organ-specific manner in homeostasis.
• Synonyms: BD73; EAR-1R; RVR
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%; Sheep: 92%

Reference Data

• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transcription Factors