DLX5 Rabbit Polyclonal Antibody

CAT#: TA343517

Rabbit Polyclonal Anti-DLX5 Antibody

Product Images

WB Suggested Anti-DLX5 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Transfected 293T

• 

  Human Heart

• 

  Human Liver

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DLX5 antibody: synthetic peptide directed towards the N terminal of human DLX5. Synthetic peptide located within the following region: MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: distal-less homeobox 5
• Database Link:
  NP_005212
  Entrez Gene 1749 Human
  UniProt ID P56178
• Background: DLX5 is a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. This protein may play a role in bone development and fracture healing. Mutation in its gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation.This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein may play a role in bone development and fracture healing. Mutation in this gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation.
• Synonyms: SHFM1D
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%

Reference Data

• Protein Families: ES Cell Differentiation/IPS, Transcription Factors