EWSR1 Rabbit Polyclonal Antibody

CAT#: TA343522

Rabbit Polyclonal Anti-EWSR1 Antibody

Product Images

WB Suggested Anti-EWSR1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Jurkat cell lysate.EWSR1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Lanes: Lane 1: 50ug Hela Lysate; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Anti-rabbit-HRP; Secondary Antibody Dilution: 1: 10, 000; Gene Name: EWSR1; Submitted by: Archa Fox, University of Western Australia; EWSR1 is strongly supported by B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EWSR1 antibody: synthetic peptide directed towards the middle region of human EWSR1. Synthetic peptide located within the following region: RGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGPGKMDKGEHRQERRDRPY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 68 kDa
• Gene Name: EWS RNA binding protein 1
• Database Link:
  NP_005234
  Entrez Gene 2130 Human
  UniProt ID Q01844
• Background: EWSR1 is a putative RNA binding protein. Mutations in this gene, specifically a t(11;22)(q24;q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in two products.This gene encodes a putative RNA binding protein. Mutations in this gene, specifically a t(11;22)(q24;q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in two products.
• Synonyms: bK984G1.4; EWS; EWS-FLI1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 77%

Reference Data

• Protein Families: Druggable Genome, Stem cell - Pluripotency, Transcription Factors