HCFC1 Rabbit Polyclonal Antibody

CAT#: TA343526

Rabbit Polyclonal Anti-HCFC1 Antibody

Product Images

Lanes: Lane 1: HIS-HCFC1 16-363aa (42kD) transformed bacteria lysate; Lane 2: GFP-HCFC1 363-2002aa (73kD) transformed bacteria lysate elution sample; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Anti-rabbit AlexaFluor 680; Secondary Antibody Dilu

• 

  WB Suggested Anti-HCFC1 Antibody Titration: 1.25 ug/ml; Positive Control: HepG2 cell lysate; HCFC1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HCFC1 antibody: synthetic peptide directed towards the N terminal of human HCFC1. Synthetic peptide located within the following region: GTRLLVFGGMVEYGKYSNDLYELQASRWEWKRLKAKTPKNGPPPCPRLGH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: host cell factor C1
• Database Link:
  NP_005325
  Entrez Gene 3054 Human
  UniProt ID P51610
• Background: HCFC1 is a member of the host cell factor family with five Kelch repeats, a fibronectin-like motif, and six HCF repeats, each of which contains a highly specific cleavage signal. This nuclear coactivator is proteolytically cleaved at one of the six possible sites, resulting in the creation of an N-terminal chain and the corresponding C-terminal chain. The final form of this protein consists of noncovalently bound N- and C-terminal chains. The protein is involved in control of the cell cycle and transcriptional regulation during herpes simplex virus infection.
• Synonyms: CFF; HCF; HCF-1; HCF1; HFC1; MRX3; PPP1R89; VCAF
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%

Reference Data

• Protein Families: Transcription Factors