TBX3 Rabbit Polyclonal Antibody

CAT#: TA343574

Rabbit Polyclonal Anti-TBX3 Antibody

Product Images

Host: Rabbit; Target Name: TBX3; Sample Tissue: Fetal Liver lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TBX3 antibody is: synthetic peptide directed towards the C-terminal region of Human TBX3. Synthetic peptide located within the following region: SRSSTLSSSSMSLSPKLCAEKEAATSELQSIQRLVSGLEAKPDRSRSASP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 66 kDa
• Gene Name: T-box 3
• Database Link:
  NP_005987
  Entrez Gene 6926 Human
  UniProt ID O15119
• Background: TBX3 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This protein is a transcriptional repressor and is thought to play a role in the anterior/posterior axis of the tetrapod forelimb. Mutations in this gene cause ulnar-mammary syndrome, affecting limb, apocrine gland, tooth, hair, and genital development. Alternative splicing of this gene results in three transcript variants encoding different isoforms; however, the full length nature of one variant has not been determined.
• Synonyms: TBX3-ISO; UMS; XHL
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Dog: 93%; Rabbit: 93%; Pig: 86%; Rat: 86%; Mouse: 86%; Zebrafish: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors