Plzf (ZBTB16) Rabbit Polyclonal Antibody

CAT#: TA343575

Rabbit Polyclonal Anti-ZBTB16 Antibody

Product Images

WB Suggested Anti-ZBTB16 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: 721_B cell lysate

• 

  Lanes: 1. 50 ug untransfected HEK293T lysate; 2. 50 ug ZBTB16 transfected HEK293T lysate; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Donkey Anti-rabbit AP; Secondary Antibody Dilution: 1: 2000; Gene Name: ZBTB16; Submitted by: Anonymous;

• 

  Lanes: 1. 50 ug untransfected HEK293T lysate; 2. 50 ug ZBTB16 transfected HEK293T lysate; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Donkey Anti-rabbit AP; Secondary Antibody Dilution: 1: 2000; Gene Name: ZBTB16; Submitted by: Anonymous;

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZBTB16 antibody: synthetic peptide directed towards the C terminal of human ZBTB16. Synthetic peptide located within the following region: GASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPDWRIEKTYLYLCYV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 74 kDa
• Gene Name: zinc finger and BTB domain containing 16
• Database Link:
  NP_005997
  Entrez Gene 7704 Human
  UniProt ID Q05516
• Background: ZBTB16 is a member of the Krueppel C2H2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine Kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in cell cycle progression, and interacts with a histone deacetylase. Specific instances of aberrant gene rearrangement at this locus have been associated with acute promyelocytic leukemia (APL). Alternate transcriptional splice variants have been characterized.This gene is a member of the Krueppel C2H2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine Kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in cell cycle progression, and interacts with a histone deacetylase. Specific instances of aberrant gene rearrangement at this locus have been associated with acute promyelocytic leukemia (APL). Alternate transcriptional splice variants have been characterized.
• Synonyms: PLZF; ZNF145
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Acute myeloid leukemia, Pathways in cancer