Tfdp1 Rabbit Polyclonal Antibody

CAT#: TA343658

Rabbit Polyclonal Anti-Tfdp1 Antibody

Product Images

WB Suggested Anti-Tfdp1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Mouse Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Tfdp1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NLSPGKGVVSLVAVHPSTVNTLGKQLLPKTFGQSNVNITQQVVIGTPQRP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: transcription factor Dp 1
• Database Link:
  NP_033387
  Entrez Gene 21781 Mouse
  UniProt ID Q08639
• Background: Tfdp1 can stimulate E2F-dependent transcription. Tfdp1 binds DNA cooperatively with E2F family members through the E2 recognition site, 5'-TTTC[CG]CGC-3', found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DP2/E2F complex functions in the control of cell-cycle progression from G1 to S phase. The E2F-1/DP complex appears to mediate both cell proliferation and apoptosis.
• Synonyms: Dp-1; DP1; DRTF1
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%