Ppargc1a Rabbit Polyclonal Antibody

CAT#: TA343709

Rabbit Polyclonal Anti-Ppargc1a Antibody

Product Images

WB Suggested Anti-Ppargc1a Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Mouse Brain

• 

  Lanes: Lane 1: 20 ug cytosolic fraction mesangial cells; Lane 2: 20 ug cytosolic fraction mesangial cells; Lane 3: 20 ug mitochondrial fraction mesangial cells; Lane 4: 20 ug treated cytosolic fraction mesangial cells; Lane 5: 20 ug Myometrial tissue lysate; P

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Ppargc1a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LENGYTLRRSNETDFELYFCGRKQFFKSNYADLDTNSDDFDPASTKSKYD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 90 kDa
• Gene Name: peroxisome proliferative activated receptor, gamma, coactivator 1 alpha
• Database Link:
  NP_032930
  Entrez Gene 10891 HumanEntrez Gene 19017 Mouse
  UniProt ID O70343
• Background: Ppargc1a is a transcriptional coactivator for steroid receptors and nuclear receptors. Ppargc1a greatly increases the transcriptional activity of PPARG and thyroid hormone receptor on the uncoupling protein promoter. Ppargc1a can regulate key mitochondrial genes that contribute to the program of adaptive thermogenesis.
• Synonyms: LEM6; PGC-1(alpha); PGC-1-alpha; PGC-1v; PGC1; PGC1A; PPARGC-1-alpha; PPARGC1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Goat: 93%; Mouse: 93%; Zebrafish: 93%; Bovine: 86%