UHRF1 Rabbit Polyclonal Antibody

CAT#: TA343712

Rabbit Polyclonal Anti-UHRF1 Antibody

Product Images

WB Suggested Anti-UHRF1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Stomach

• 

  WB Suggested Anti-UHRF1 Antibody; Positive Control: Lane 1: 60ug HCT116 lysate Lane 2: 60ug HCT116 lysate + siRNA; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Anti rabbit-HRP; Secondry Antibody Dilution: 1: 5, 000; Submitted by: Chinweike Ukom

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-UHRF1 antibody: synthetic peptide directed towards the N terminal of human UHRF1. Synthetic peptide located within the following region: MGVFAVPPLSADTMWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 91 kDa
• Gene Name: ubiquitin like with PHD and ring finger domains 1
• Database Link:
  NP_037414
  Entrez Gene 29128 Human
  UniProt ID Q96T88
• Background: This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2
• Synonyms: hNP95; hUHRF1; huNp95; ICBP90; Np95; RNF106
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rat: 86%; Guinea pig: 86%; Dog: 79%; Mouse: 79%; Bovine: 79%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors