Zbtb44 Rabbit Polyclonal Antibody

CAT#: TA343720

Rabbit Polyclonal Anti-Zbtb44 Antibody

Product Images

WB Suggested Anti-Zbtb44 Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Zbtb44 antibody is: synthetic peptide directed towards the N-terminal region of Rat Zbtb44. Synthetic peptide located within the following region: VKTFTHSSSSHSQEMLGKLNMLRNDGHFCDITIRVQDRIFRAHKVVLAAC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: zinc finger and BTB domain containing 44
• Database Link:
  NP_001030114
  Entrez Gene 363035 Rat
  UniProt ID Q3SWU4
• Background: The function of this protein remains unknown.
• Synonyms: BTBD15; HSPC063; MGC26123; MGC57431; MGC60348; MGC88058; ZNF851
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%