NR2E3 Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of nuclear receptor subfamily 2, group E, member 3 (NR2E3), transcript variant 2
USD 325.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 159.00
Other products for "NR2E3"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-NR2E3 antibody: synthetic peptide directed towards the N terminal of human NR2E3. Synthetic peptide located within the following region: METRPTALMSSTVAAAAPAAGAASRKESPGRWGLGEDPTGVSPSLQCRVC |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 45 kDa |
Gene Name | nuclear receptor subfamily 2 group E member 3 |
Database Link | |
Background | NR2E3 is part of a large family of nuclear receptor transcription factors involved in signaling pathways. Nuclear receptors have been shown to regulate pathways involved in embryonic development, as well as in maintenance of proper cell function in adults. NR2E3 is a retinal nuclear receptor that is a ligand-dependent transcription factor. Defects in this gene are a cause of enhanced S cone syndrome.This protein is part of a large family of nuclear receptor transcription factors involved in signaling pathways. Nuclear receptors have been shown to regulate pathways involved in embryonic development, as well as in maintenance of proper cell function in adults. Members of this family are characterized by discrete domains that function in DNA and ligand binding. This gene encodes a retinal nuclear receptor that is a ligand-dependent transcription factor. Defects in this gene are a cause of enhanced S cone syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Synonyms | ESCS; PNR; rd7; RNR; RP37 |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 93%; Bovine: 86%; Pig: 79% |
Reference Data | |
Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.