NR2E3 Rabbit Polyclonal Antibody

CAT#: TA343726

Rabbit Polyclonal Anti-NR2E3 Antibody

Product Images

Host: Rabbit; Target Name: NR2E3; Sample Tissue: OVCAR-3 Whole cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-NR2E3 antibody is: synthetic peptide directed towards the C-terminal region of Human NR2E3. Synthetic peptide located within the following region: EHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERIELL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: nuclear receptor subfamily 2 group E member 3
• Database Link:
  NP_055064
  Entrez Gene 10002 Human
  UniProt ID Q9Y5X4
• Background: The function of this protein remains unknown.
• Synonyms: ESCS; PNR; rd7; RNR; RP37
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transcription Factors