SART3 Rabbit Polyclonal Antibody

CAT#: TA343751

Rabbit Polyclonal Anti-SART3 Antibody

Product Images

WB Suggested Anti-SART3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HT1080 cell lysate; SART3 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SART3 antibody: synthetic peptide directed towards the middle region of human SART3. Synthetic peptide located within the following region: LSLLPRALQRPSAAAPQAENGPAAAPAVAAPAATEAPKMSNADFAKLFLR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 110 kDa
• Gene Name: squamous cell carcinoma antigen recognized by T-cells 3
• Database Link:
  NP_055521
  Entrez Gene 9733 Human
  UniProt ID Q15020
• Background: SART3 is an RNA-binding nuclear protein that is a tumor-rejection antigen. This antigen possesses tumor epitopes capable of inducing HLA-A24-restricted and tumor-specific cytotoxic T lymphocytes in cancer patients and may be useful for specific immunother
• Synonyms: DSAP1; P100; p110; p110(nrb); RP11-13G14; TIP110
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Horse: 93%; Rabbit: 93%; Bovine: 92%; Mouse: 87%; Guinea pig: 76%